Recombinant Nitrobacter winogradskyi Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Nitrobacter winogradskyi Beta-(1→2)glucan Export ATP-Binding/Permease Protein NdvA (ndvA)

The recombinant NdvA protein from Nitrobacter winogradskyi is an ATP-binding transporter belonging to the ABC transporter superfamily. It facilitates the export of beta-(1→2)glucan, a polysaccharide critical for bacterial cell wall integrity and symbiotic interactions in related species like Agrobacterium tumefaciens and Rhizobium meliloti. Structurally, NdvA comprises transmembrane domains (TMDs) forming an inner membrane pore and nucleotide-binding domains (NBDs) that hydrolyze ATP to drive substrate transport .

2.1. Domain Organization

NdvA’s structure aligns with canonical ABC transporters:

  • Transmembrane Domains (TMDs):

    • Form a pore in the inner membrane for substrate passage.

    • Include hydrophobic regions (e.g., residues 141–155 in NdvA) for membrane integration .

  • Nucleotide-Binding Domains (NBDs):

    • Contain Walker A and B motifs for ATP binding/hydrolysis.

    • Sequence homology with HlyB and Mdr highlights conserved ATPase activity .

2.2. Sequence Homology

NdvA shares significant identity with orthologs in other bacteria:

SpeciesProteinIdentityKey Features
Nitrobacter winogradskyiNdvAN/AExporter for beta-(1→2)glucan
Rhizobium melilotiNdvA~76% (vs. Agrobacterium ChvA) Symbiosis-related glucan export
Rhodopseudomonas palustrisNdvA~38–78% (vs. Rhizobiales) Acyl-HSL production linked to quorum sensing

Role in Beta-(1→2)glucan Export

Mutational studies in Agrobacterium and Rhizobium demonstrated that NdvA/ChvA mutants accumulate intracellular glucan, confirming its export role . In Nitrobacter, while direct evidence is limited, genomic studies suggest NdvA may contribute to extracellular polysaccharide production, potentially aiding biofilm formation or stress resistance .

3.1. Experimental Validation

  • Wild-Type vs. Mutant Phenotypes:

    • Wild-Type: Active glucan secretion.

    • Mutant: Defective export, retained glucan in cytoplasm/periplasm .

  • Biochemical Assays:

    • ATPase activity linked to NBDs validates energy-dependent transport .

4.1. Production Strategies

Recombinant NdvA is typically expressed in E. coli with an N-terminal His-tag for purification . Key parameters include:

ParameterDetail
Expression SystemE. coli (BL21(DE3) or similar)
Purity>90% (SDS-PAGE-verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

4.2. Applications in Research

  • Structural Studies:

    • Hydropathy plots reveal membrane topology (Fig. 6 in ).

  • Functional Assays:

    • ATP-dependent glucan transport reconstitution in vitro .

  • Comparative Genomics:

    • Genome sequencing of Nitrobacter highlights transport-related genes (10% of genome) .

Comparative Analysis of NdvA Orthologs

SpeciesLength (aa)Key Distinguishing Features
N. winogradskyi609GC-rich genome (62%) ; chemolithotrophic context
Rhizobium radiobacter588Synonyms include chvA; attachment protein role
Rhodopseudomonas palustris599Acyl-HSL synthesis linked to quorum sensing

Research Gaps and Future Directions

  • Functional Specificity:

    • Role in Nitrobacter’s nitrification cycle remains unclear.

  • Biotechnological Potential:

    • Engineering NdvA for enhanced polysaccharide production.

  • Evolutionary Context:

    • Phylogenetic analysis of ABC transporters in nitrifiers .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndvA; Nwi_2681; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Target Names
ndvA
Target Protein Sequence
MSMVRLYTRVLELLGAEARLGWILAGANLLLAGAQFAEPVLFGRIIDVLSGNPASGLFGM ASTSPWPLLAVWAAFGLFTILCGVTVALQADRLSHRQRQAVLTGYFEHIMQLPLAYHAGT HSGRLMKVMLQGTDALWRLWLGFFREHFAAMMSLVVLLPLSLYINWRLAILLFALCIVFT MLTTLVVRRTFDMQNEVEAHFSDLSARASDALGNVALVQSFVRVDAEVQGLRFVVDKLLS AQMPVLSWWAVVTVMTRASTTITILAIFTAGIALNQRGMTSIGEIVMFVSFATMLIQRLE QVVSFINSVFMEAPRLKEFFDVLDAVPAVRDRPDAVDPGRLQGRVEFNDVSFSYDSKRPA VANLSFVASPGETIALVGPTGAGKSTAVALLHRAFDPQSGIIRIDGMDIRDLTLSGLRRN IGVVFQEPLLFNRSIAENLRVGKPDATDEEMRLAAGRAQALDFIERGEKKFDTHAGERGR MLSGGERQRLSIARALLKDPPILILDEATSALDAVTEAKVNAALDEVMKGRTTFVIAHRL STIRNAARILVFADGRVIESGTFGELLANGGHFAQLAKAQFMTQESTQADLSSSRTNPAV EIRPLSLGN
Uniprot No.

Target Background

Function
This protein is involved in beta-(1-->2)glucan export. Its transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the ndvA gene in Nitrobacter winogradskyi?

The ndvA gene in Nitrobacter winogradskyi encodes an ATP-binding/permease protein that plays a crucial role in the export of beta-(1-->2)glucan from the cell. Based on research on homologous genes in related bacteria, the NdvA protein belongs to a family of bacterial ATP-binding transport proteins . Evidence suggests that this protein is fundamentally important for exporting cyclic extracellular polysaccharides, which are essential components of bacterial cell communication and environmental adaptation mechanisms in various species .

How is the ndvA gene related to other bacterial export proteins?

The ndvA gene product shows significant homology to several bacterial ATP-binding transport proteins. Most notably, it shares substantial sequence similarity with Escherichia coli HlyB, a protein involved in hemolysin export . Additionally, it bears resemblance to the mdr gene product of mammalian cells, which is also thought to be involved in cellular export processes . This evolutionary conservation across different bacterial species and even into eukaryotic systems suggests the fundamental importance of this transport mechanism.

What is known about beta-(1-->2)glucan in bacteria like Nitrobacter winogradskyi?

Beta-(1-->2)glucan is a cyclic extracellular polysaccharide that has been identified as an important component in bacterial physiology. In related bacterial systems, beta-(1-->2)glucan production involves a 235,000-dalton protein intermediate that functions in the synthesis pathway . The export of this molecule from cells appears to be facilitated by the NdvA protein. Based on studies in other bacteria like Rhizobium meliloti, mutants lacking functional ndvA genes retain the ability to synthesize the glucan intermediate but fail to export the finished product extracellularly .

How should experiments be designed to verify the function of recombinant ndvA in Nitrobacter winogradskyi?

When designing experiments to verify ndvA function, researchers should implement a multi-faceted approach:

  • Gene knockout studies: Create ndvA mutants in N. winogradskyi and analyze phenotypic changes, particularly focusing on beta-(1-->2)glucan export.

  • Complementation assays: Reintroduce recombinant ndvA into mutant strains to confirm restoration of function.

  • Protein localization: Use fluorescent tagging or immunolocalization to confirm membrane localization of the NdvA protein.

  • Transport assays: Measure beta-(1-->2)glucan production and export rates using radiolabeled precursors.

  • Cross-species functionality: Test whether the N. winogradskyi ndvA can complement mutations in related species like Rhizobium meliloti .

The experimental design should incorporate appropriate controls and consider the optimal growth conditions for N. winogradskyi, which include a medium containing NaNO₂ (5.74 g l⁻¹) and glycerol (37.88 mmol l⁻¹), at pH 7.83, 28°C, with agitation at 120 rev min⁻¹ .

What techniques are most effective for expressing recombinant ndvA protein in laboratory settings?

For optimal expression of recombinant ndvA protein, researchers should consider:

  • Expression system selection: E. coli systems may be suitable for initial studies, but homologous expression in Nitrobacter or related species may better preserve functional characteristics.

  • Codon optimization: Adapt the ndvA gene sequence to the preferred codon usage of the expression host.

  • Induction conditions: Optimize temperature, inducer concentration, and duration based on the specific expression system.

  • Membrane protein considerations: As an ATP-binding/permease protein, NdvA is likely membrane-associated, requiring specialized extraction protocols using detergents.

  • Purification strategy: Implement affinity tags that minimally interfere with protein function, followed by size-exclusion chromatography.

When working with Nitrobacter winogradskyi specifically, consider the organism's slow growth rate, which may necessitate extended cultivation periods . Incorporation of glycerol in the media has been shown to enhance cell division and growth by increasing the accumulation of polyphosphates and phosphorus .

How can researchers effectively study the ATP-binding characteristics of the NdvA protein?

To characterize the ATP-binding properties of NdvA:

  • ATP-binding assays: Employ techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to measure binding affinities.

  • ATPase activity measurements: Quantify ATP hydrolysis rates using phosphate release assays.

  • Mutational analysis: Create point mutations in the ATP-binding domain to identify critical residues.

  • Structural studies: Implement crystallography or cryo-EM approaches to visualize the ATP-binding pocket.

  • Nucleotide specificity testing: Determine whether the protein binds exclusively to ATP or can utilize other nucleotides.

When designing these experiments, consider that the ndvA gene product is approximately 67,100 daltons based on sequence analysis of related proteins . This information is critical for confirming the identity of purified protein samples.

How can researchers differentiate between direct and indirect effects of ndvA mutations on bacterial physiology?

To distinguish direct from indirect effects of ndvA mutations:

  • Comprehensive phenotyping: Analyze multiple aspects of cellular physiology beyond just beta-(1-->2)glucan production.

  • Time-course experiments: Track the temporal sequence of physiological changes after ndvA disruption.

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and ndvA mutants to identify affected pathways.

  • Metabolomic comparisons: Analyze changes in metabolite profiles to identify metabolic shifts.

  • Rescue experiments: Test whether exogenously provided beta-(1-->2)glucan can rescue phenotypic defects.

Research in related systems indicates that ndvA mutations can affect multiple aspects of bacterial physiology. For instance, in Rhizobium meliloti, ndvA mutants exhibited reduced motility and formed abnormal nodules on alfalfa roots in addition to defects in beta-(1-->2)glucan production .

What are the key considerations when comparing NdvA function across different bacterial species?

When conducting comparative analyses of NdvA function:

  • Sequence alignment quality: Ensure that comparisons are based on robust sequence alignments that identify truly homologous regions.

  • Evolutionary context: Consider the evolutionary relationships between species being compared.

  • Functional conservation verification: Test whether proteins from different species can functionally complement each other.

  • Domain architecture analysis: Compare the arrangement of functional domains across species.

  • Ecological niche considerations: Interpret functional differences in the context of each species' ecological niche and lifestyle.

Research has demonstrated that the ndvA locus of Rhizobium meliloti is homologous to and can substitute for the chvA locus of Agrobacterium tumefaciens, indicating functional conservation across these species . This suggests that comparing NdvA function across different bacterial species, including Nitrobacter winogradskyi, can provide valuable insights into conserved and species-specific aspects of beta-(1-->2)glucan export.

What are the optimal growth conditions for Nitrobacter winogradskyi when studying ndvA function?

The optimal growth conditions for Nitrobacter winogradskyi have been experimentally determined through response surface methodology:

ParameterOptimal ValueNotes
NaNO₂ concentration5.74 g l⁻¹Provides energy source for growth
Glycerol concentration37.88 mmol l⁻¹Enhances cell division and growth
pH7.83Optimal for enzymatic activity
Temperature28°CSupports maximal growth rate
Agitation120 rev min⁻¹Ensures proper aeration

These conditions are based on a modified DSMZ 756a medium and have been shown to increase growth yield by 5.06 times compared to basal medium . High concentrations of NaNO₂ provide sufficient energy for growth and contribute to the generation of carboxysomes in cells for CO₂ fixation, while glycerol enhances cell division by increasing the accumulation of polyphosphates .

How can researchers accurately detect and quantify beta-(1-->2)glucan export in Nitrobacter winogradskyi?

For detection and quantification of beta-(1-->2)glucan export:

  • Radiolabeling: Incorporate ¹⁴C-labeled precursors to track newly synthesized beta-(1-->2)glucan.

  • Immunological methods: Develop specific antibodies against beta-(1-->2)glucan for immunodetection.

  • Chromatographic separation: Use HPLC or similar techniques to isolate and quantify the polysaccharide.

  • Mass spectrometry: Implement MS approaches to identify and quantify beta-(1-->2)glucan.

  • Fluorescent staining: Develop specific fluorescent probes for microscopic visualization.

Research in related bacterial systems has employed techniques like fractionation of cells into outer membrane, cytoplasmic membrane, periplasmic, and cytoplasmic components to track the localization of beta-(1-->2)glucan intermediates . Additionally, autoradiography combined with immunofluorescence has been used to simultaneously detect bacteria and assess their metabolic activity .

What approaches can be used to study the protein-protein interactions of NdvA in the membrane transport complex?

To investigate NdvA protein-protein interactions:

  • Co-immunoprecipitation: Pull down NdvA and identify interacting partners using mass spectrometry.

  • Bacterial two-hybrid systems: Adapt two-hybrid approaches for membrane protein interaction studies.

  • FRET/BRET analysis: Use fluorescence or bioluminescence resonance energy transfer to detect interactions in vivo.

  • Cross-linking studies: Employ chemical cross-linking followed by mass spectrometry to identify neighboring proteins.

  • Split-protein complementation assays: Design systems where protein fragments reconstitute a detectable signal when interaction occurs.

When implementing these approaches, consider that membrane fractionation techniques have been successfully applied to related bacteria to isolate membrane components . Additionally, the understanding that NdvA is likely part of a larger export complex involving the 235,000-dalton protein intermediate should inform experimental design .

How should researchers approach the study of ndvA gene regulation in Nitrobacter winogradskyi?

To investigate ndvA gene regulation:

  • Promoter analysis: Identify and characterize the promoter region using reporter gene fusions.

  • Transcription factor identification: Implement DNA-protein interaction studies to identify regulatory proteins.

  • Environmental response profiling: Analyze ndvA expression under different growth conditions.

  • Global regulatory network mapping: Use RNA-seq to place ndvA in the context of global gene regulation.

  • Epigenetic regulation: Investigate potential DNA methylation or other epigenetic mechanisms affecting expression.

When studying gene regulation in Nitrobacter winogradskyi, researchers should consider that this organism participates in biogeochemical cycling of nitrogen by catalyzing and conserving energy from the oxidation of nitrite to nitrate . This metabolic context may provide insights into the environmental signals that regulate ndvA expression.

How does ndvA function integrate with the broader nitrogen and carbon metabolism of Nitrobacter winogradskyi?

The integration of ndvA function with nitrogen and carbon metabolism can be explored through:

  • Metabolic flux analysis: Trace carbon and nitrogen flow through central metabolism in wild-type and ndvA mutants.

  • Respiratory chain interactions: Investigate potential interactions between NdvA and components of the respiratory chain.

  • Energy coupling mechanisms: Determine how ATP utilization by NdvA affects cellular energy balance.

  • Carboxysome interactions: Explore relationships between beta-(1-->2)glucan export and carboxysome formation.

  • Metabolic modeling: Develop computational models of N. winogradskyi metabolism incorporating ndvA function.

Genomic analysis of Nitrobacter winogradskyi has revealed genes encoding pathways for both lithotrophic and heterotrophic growth, including multiple enzymes involved in anapleurotic reactions centered on C2 to C4 metabolism . Understanding how ndvA function fits within this metabolic network will provide insights into its physiological significance.

What are the ecological implications of ndvA function in environmental nitrogen cycling?

To understand the ecological significance of ndvA:

  • Field sampling: Compare ndvA sequence and expression in environmental Nitrobacter populations.

  • Microcosm experiments: Analyze how ndvA mutations affect Nitrobacter function in simulated environments.

  • Community interaction studies: Investigate how beta-(1-->2)glucan export affects interactions with other microorganisms.

  • Biofilm formation analysis: Explore the role of exported polysaccharides in environmental biofilm development.

  • Niche adaptation studies: Compare ndvA sequences from Nitrobacter strains adapted to different environments.

Nitrobacter winogradskyi is an important nitrite-oxidizing bacterium participating in the second step of nitrification in water and soil . Understanding the role of ndvA in this context may provide insights into factors affecting the efficiency of environmental nitrogen cycling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.